Protein Info for SMc00174 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 transmembrane" amino acids 125 to 144 (20 residues), see Phobius details amino acids 170 to 190 (21 residues), see Phobius details amino acids 205 to 228 (24 residues), see Phobius details amino acids 249 to 295 (47 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details amino acids 356 to 377 (22 residues), see Phobius details TIGR00056: ABC transport permease subunit" amino acids 161 to 372 (212 residues), 213.7 bits, see alignment E=1.9e-67 PF02405: MlaE" amino acids 162 to 372 (211 residues), 234.5 bits, see alignment E=5.1e-74

Best Hits

KEGG orthology group: K02066, putative ABC transport system permease protein (inferred from 100% identity to smk:Sinme_1739)

Predicted SEED Role

"ABC-type transport system involved in resistance to organic solvents, permease component USSDB6A"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92PD5 at UniProt or InterPro

Protein Sequence (379 amino acids)

>SMc00174 hypothetical protein (Sinorhizobium meliloti 1021)
MTRAPTETAADVVVDEGAAGNGRRYVFSGDWRHETAEAMAAKLKRLEKPAGGQSEFDFSG
ITRMDTAGAWIIRRFMNGTADEVRFTGGERYAELVRALPKQLRRPEESATRMPLFQRLFT
PVGELTVSIWTDTVAAMFILGSAVRGAQMKLGRHAGVSPAAIVHQIDRMGVMATPIITLM
SFLIGAIIAQQGAFQLRSFGAEIFVVDLVGILQLREIGVLLTAIMIAGRSGSAITAEIGS
MKMREEVDALKVMGLSPVGVLVFPRLVALTIVLPLLTIIANFAALAGAAMVAWTYSDITI
PTFLARLQEAVDFSSVAAGMIKAPFMALIIGVVAAVEGLKVGGSAESLGRRVTSSVVKSI
FVVILIDGLFAMFYAAIDF