Protein Info for SMc00170 in Sinorhizobium meliloti 1021

Annotation: transcription regulator HSL-dependent protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 245 PF03472: Autoind_bind" amino acids 27 to 164 (138 residues), 61.8 bits, see alignment E=1.1e-20 PF08281: Sigma70_r4_2" amino acids 181 to 224 (44 residues), 29.4 bits, see alignment 1e-10 PF00196: GerE" amino acids 182 to 236 (55 residues), 66.8 bits, see alignment E=2e-22

Best Hits

KEGG orthology group: K07782, LuxR family transcriptional regulator (inferred from 100% identity to sme:SMc00170)

Predicted SEED Role

"Transcriptional activator protein LuxR" in subsystem Luciferases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92PD1 at UniProt or InterPro

Protein Sequence (245 amino acids)

>SMc00170 transcription regulator HSL-dependent protein (Sinorhizobium meliloti 1021)
MANQQAVLNLLDIVEYGGCADPERFFALMRRTFNISHLLYLEAESLPDGLRICRLHHTFG
AYAAEIYAARGLYRIDPILKLALGGVRPVEWATARRRFPECEPLFEAAEEIGLSTEGVAL
PLPSPAGRMALLAIGANMSPVEWSAYRRCHLRDFQLAANLFHASMLEHSAMAGALDERDL
RLTGRETEVLTWSAAGKSYWEIATILGISERTVRFFMTNARRKLNVVSNTQAVAHAVRHA
LIPTI