Protein Info for SMc00166 in Sinorhizobium meliloti 1021

Annotation: oxidoreductase NAD protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02476: 5,6-dimethylbenzimidazole synthase
  • amino acids 15 to 219 (205 residues), 300.5 bits, E=2.4e-94
• PF00881: Nitroreductase
  • amino acids 27 to 193 (167 residues), 115.7 bits, E=1.3e-37

Best Hits

Swiss-Prot: 100% identical to BLUB_RHIME: 5,6-dimethylbenzimidazole synthase (bluB) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K04719, 5,6-dimethylbenzimidazole synthase [EC: 1.14.99.40] (inferred from 100% identity to smk:Sinme_1747)

MetaCyc: 100% identical to aerobic 5,6-dimethylbenzimidazole synthase (Sinorhizobium meliloti)
RXN-8771 [EC: 1.13.11.79]

Predicted SEED Role

"Cobalamin biosynthesis protein BluB @ 5,6-dimethylbenzimidazole synthase, flavin destructase family"

MetaCyc Pathways

• adenosylcobalamin biosynthesis II (aerobic) (30/33 steps found)
• 5,6-dimethylbenzimidazole biosynthesis I (aerobic) (3/3 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.79 or 1.14.99.40

Sequence Analysis Tools

See Q92PC8 at UniProt or InterPro

Protein Sequence (227 amino acids)

>SMc00166 oxidoreductase NAD protein (Sinorhizobium meliloti 1021)
MLPDPNGCLTAAGAFSSDERAAVYRAIETRRDVRDEFLPEPLSEELIARLLGAAHQAPSV
GFMQPWNFVLVRQDETREKVWQAFQRANDEAAEMFSGERQAKYRSLKLEGIRKAPLSICV
TCDRTRGGAVVLGRTHNPQMDLYSTVCAVQNLWLAARAEGVGVGWVSIFHESEIKAILGI
PDHVEIVAWLCLGFVDRLYQEPELAAKGWRQRLPLEDLVFEEGWGVR