Protein Info for SMc00103 in Sinorhizobium meliloti 1021

Annotation: alpha-halocarboxylic acid dehalogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 PF00702: Hydrolase" amino acids 4 to 186 (183 residues), 61.6 bits, see alignment E=1.4e-20 TIGR01428: haloacid dehalogenase, type II" amino acids 4 to 198 (195 residues), 238 bits, see alignment E=9.5e-75 TIGR01493: HAD hydrolase, family IA, variant 2" amino acids 5 to 185 (181 residues), 181.1 bits, see alignment E=1.9e-57 PF13419: HAD_2" amino acids 92 to 192 (101 residues), 27.1 bits, see alignment E=3.9e-10

Best Hits

Swiss-Prot: 47% identical to HAD4_BURCE: (S)-2-haloacid dehalogenase 4A (hdl) from Burkholderia cepacia

KEGG orthology group: K01564, [EC: 3.8.1.-] K07025, putative hydrolase of the HAD superfamily (inferred from 100% identity to sme:SMc00103)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RC4 at UniProt or InterPro

Protein Sequence (220 amino acids)

>SMc00103 alpha-halocarboxylic acid dehalogenase (Sinorhizobium meliloti 1021)
MSYAAYVFDAYGTLFDVHAAVRRHAEAIGPDGQAFSELWRAKQLEYSWVRSLMGAYVDFW
ELTEQSLDYAFQRFPSADPKLKKPLLDAYWALDCYPEVPAVLKGLKELGARIAILSNGSP
AMLASAVKNAALDIIIDDVFSVDAVKAFKTAPAVYDLVTTSYRLYPQAVSFQSSNRWDIA
GATKFGFRTVWINRADGPDEYKDHGPSLILPSLESLQFGI