Protein Info for SMc00091 in Sinorhizobium meliloti 1021
Annotation: sulfate adenylyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to CYSD_RHIME: Sulfate adenylyltransferase subunit 2 (cysD) from Rhizobium meliloti (strain 1021)
KEGG orthology group: K00957, sulfate adenylyltransferase subunit 2 [EC: 2.7.7.4] (inferred from 100% identity to sme:SMc00091)MetaCyc: 100% identical to sulfate adenylyltransferase beta subunit (Sinorhizobium meliloti)
Sulfate adenylyltransferase. [EC: 2.7.7.4]
Predicted SEED Role
"Sulfate adenylyltransferase subunit 2 (EC 2.7.7.4)" in subsystem Cysteine Biosynthesis (EC 2.7.7.4)
MetaCyc Pathways
- superpathway of sulfate assimilation and cysteine biosynthesis (9/9 steps found)
- superpathway of L-methionine biosynthesis (by sulfhydrylation) (11/12 steps found)
- assimilatory sulfate reduction I (4/4 steps found)
- assimilatory sulfate reduction III (3/3 steps found)
- superpathway of sulfur amino acid biosynthesis (Saccharomyces cerevisiae) (8/10 steps found)
- sulfate activation for sulfonation (2/2 steps found)
- assimilatory sulfate reduction IV (3/4 steps found)
- assimilatory sulfate reduction II (1/3 steps found)
- sulfite oxidation III (1/3 steps found)
- selenate reduction (2/5 steps found)
- dissimilatory sulfate reduction I (to hydrogen sufide)) (1/5 steps found)
- superpathway of sulfur metabolism (Desulfocapsa sulfoexigens) (1/6 steps found)
- superpathway of thiosulfate metabolism (Desulfovibrio sulfodismutans) (1/6 steps found)
- superpathway of sulfide oxidation (phototrophic sulfur bacteria) (3/12 steps found)
- superpathway of seleno-compound metabolism (7/19 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 2.7.7.4
Use Curated BLAST to search for 2.7.7.4
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See P56892 at UniProt or InterPro
Protein Sequence (317 amino acids)
>SMc00091 sulfate adenylyltransferase (Sinorhizobium meliloti 1021) MPHTLPETELHNPQSTKPPLDPHLKALENEAIHIFREVAAEFERPVMLYSIGKDSSVLLH LARKAFYPGRIPFPLLHVDTGWKFREMIAFRDEMVAKYDLDLVAHTNPRGAAENVTPFTH GSALYTDIMKTEALRQALDAGQYDAAFGGARRDEEASRAKERIYSFRTPDHRWDPRNQRP ELWNVYNGMIRKGESVRAFPLSNWTEVDIWRYIQAEDIPIVPLYFAKKRPVVERDGMLIL AEDPRLELLPGEVKREEVIRFRTLGCFPLTGAIRSEADTLDDIIAELETATVSERQGRAI DRDQAGSMEKKKREGYF