Protein Info for SMc00075 in Sinorhizobium meliloti 1021

Annotation: ribosomal-protein-alanine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 PF13302: Acetyltransf_3" amino acids 24 to 167 (144 residues), 76.9 bits, see alignment E=3.8e-25 PF13420: Acetyltransf_4" amino acids 25 to 187 (163 residues), 46.6 bits, see alignment E=5.8e-16 PF00583: Acetyltransf_1" amino acids 58 to 166 (109 residues), 30.1 bits, see alignment E=7.9e-11

Best Hits

Swiss-Prot: 37% identical to RIMJ_SHIFL: [Ribosomal protein S5]-alanine N-acetyltransferase (rimJ) from Shigella flexneri

KEGG orthology group: K03790, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 100% identity to smk:Sinme_0627)

MetaCyc: 37% identical to ribosomal-protein-S5-alanine N-acetyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-18434 [EC: 2.3.1.267]

Predicted SEED Role

"Ribosomal-protein-S5p-alanine acetyltransferase" in subsystem Ribosomal protein S5p acylation or Ribosome biogenesis bacterial

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.128

Use Curated BLAST to search for 2.3.1.128 or 2.3.1.267

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RF7 at UniProt or InterPro

Protein Sequence (203 amino acids)

>SMc00075 ribosomal-protein-alanine acetyltransferase (Sinorhizobium meliloti 1021)
MTRSVFRFLSRQPETVEIASQHYLLRLPRYADYRQWYRLRSESRAFLEPWEPTWRADEMT
EGAFRSRVNRNEQEFASGQAVPLFLFHKPDETLLGGLTIGHIRRGAAQNCMIGYWMGQKH
AGQGHMYEALKLTIPYIFKGLELHRIEAACIPENARSIRLLEKAGFEREGYLRQYLKING
QWRDHLMFSLLSVDAVPNRNLPL