Protein Info for SMc00064 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 155 PF03692: CxxCxxCC" amino acids 24 to 91 (68 residues), 50.1 bits, see alignment E=1.9e-17

Best Hits

Swiss-Prot: 100% identical to Y1011_RHIME: UPF0260 protein R01011 (R01011) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K09160, hypothetical protein (inferred from 99% identity to smk:Sinme_0722)

Predicted SEED Role

"conserved protein of unknown function; putative YcgN protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92R94 at UniProt or InterPro

Protein Sequence (155 amino acids)

>SMc00064 hypothetical protein (Sinorhizobium meliloti 1021)
MGETPFWKTKGLEEMTGAEWESLCDGCGLCCLNKLEDWDSSEIAWTSIRCTLLDGESCRC
KDYDNRQATVPDCIQLTPKAVREISWLPPTCGYRLVAEGRDLYWWHPLVSGDPETVHAAG
ISVRGRTVAEDGIDIEDYEDYLVTWPLEVGREPAD