Protein Info for SMc00055 in Sinorhizobium meliloti 1021

Annotation: monovalent cation/H+ antiporter subunit E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 44% identical to MRPE_BACPE: Na(+)/H(+) antiporter subunit E (mrpE) from Bacillus pseudofirmus (strain OF4)

KEGG orthology group: K05569, multicomponent Na+:H+ antiporter subunit E (inferred from 100% identity to sme:SMc00055)

Predicted SEED Role

"Na(+) H(+) antiporter subunit E" in subsystem Sodium Hydrogen Antiporter

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92R99 at UniProt or InterPro

Protein Sequence (158 amino acids)

>SMc00055 monovalent cation/H+ antiporter subunit E (Sinorhizobium meliloti 1021)
MKFLLTNLVFTLIWGAISASFTPANLLLGFAAGALSLWLIRRELRPVAYPLRPLRLLLLA
SLFFKELAISATKVAVLVLRSNMALKPGIFAYPLALRSDFEITLLANLITLTPGTLSVDV
SDDRNTLYVHALDCADPGALRRDIAGGFERRIREAFER