Protein Info for SMc00032 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 transmembrane" amino acids 18 to 39 (22 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 73 to 92 (20 residues), see Phobius details amino acids 98 to 119 (22 residues), see Phobius details amino acids 129 to 150 (22 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details PF03729: DUF308" amino acids 23 to 91 (69 residues), 44 bits, see alignment E=1.1e-15 amino acids 79 to 146 (68 residues), 37 bits, see alignment E=1.7e-13

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_0661)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RD7 at UniProt or InterPro

Protein Sequence (182 amino acids)

>SMc00032 hypothetical protein (Sinorhizobium meliloti 1021)
MVHASDPAGREALAGKWGWFVALGVLLIMCGGIAFGNLLMATVASVYYVGLIMLIGGLLN
LAHAFQVKSWGSVLYWILSGAFYAAAGLFAFINPVLASSVLTFLLALALIAAGCSRIWVG
FRLRPLGGWGWMVIGGLVTLLAGLIIAAGWPVDSLWILGLFLAVDLVMQGLASIAFGVLA
RG