Protein Info for SMc00013 in Sinorhizobium meliloti 1021

Annotation: cytochrome C oxidase subunit III transmembrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 292 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 55 to 74 (20 residues), see Phobius details amino acids 95 to 116 (22 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 182 to 200 (19 residues), see Phobius details amino acids 219 to 243 (25 residues), see Phobius details amino acids 263 to 283 (21 residues), see Phobius details PF00510: COX3" amino acids 9 to 283 (275 residues), 303.1 bits, see alignment E=1.1e-94

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 100% identity to sme:SMc00013)

Predicted SEED Role

"Cytochrome c oxidase polypeptide III (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92RG5 at UniProt or InterPro

Protein Sequence (292 amino acids)

>SMc00013 cytochrome C oxidase subunit III transmembrane protein (Sinorhizobium meliloti 1021)
MAGAHQKQHDYHIIDPSPWPLLASIGAFVMAFGGVGYMRYLSGGSFKMFGLEFANPWVFF
IGLALILYTMFGWWSDTIKEAHEGHHTRVVSLHLRYGMIMFIASEVMFFAAWFWAFFDAS
LFPGEAIQAARAEFTGGVWPPKGIEVLDPWHLPLYNTVILLLSGTTATWAHHALLHNDRK
GLVYGLTLTVMLGVLFSYVQGYEYAHAPFAFKDSIYGATFFMATGFHGFHVLVGTIFLLV
CLLRALRGDFTPKHHFGFEAAAWYWHFVDVVWLFLFFSIYIWGGWGAPIAHG