Protein Info for SMa2408 in Sinorhizobium meliloti 1021

Annotation: RhbE rhizobactin siderophore biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 PF13434: Lys_Orn_oxgnase" amino acids 6 to 347 (342 residues), 375.8 bits, see alignment E=1e-116 TIGR04439: putative histamine N-monooxygenase" amino acids 7 to 437 (431 residues), 770.5 bits, see alignment E=2.1e-236

Best Hits

Swiss-Prot: 100% identical to RHBE_RHIME: Rhizobactin siderophore biosynthesis protein RhbE (rhbE) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 100% identity to sme:SMa2408)

MetaCyc: 100% identical to 1,3-diaminopropane N-monooxygenase (Sinorhizobium meliloti Rm2011)
1.14.13.M65 [EC: 1.14.13.M65]

Predicted SEED Role

"Siderophore biosynthesis protein, monooxygenase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.- or 1.14.13.M65

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q9Z3Q8 at UniProt or InterPro

Protein Sequence (456 amino acids)

>SMa2408 RhbE rhizobactin siderophore biosynthesis protein (Sinorhizobium meliloti 1021)
MIMTDFDLAGIGIGPFNLGLAALLSSHENLSNVFLERKPAFRWHEGLILPGTTLQVPFMA
DLVTMADPTHRLSFLNYLAVHDRLYKFYFYENFMIPRQEYDHYCRWASQQLSACRFGEEV
VDVAHESASDSFIVESRSASGGKQQYRSRNIAIGVGTAPFLPKWAQIKTLAPLMHSSEFG
RRRLELSKRRRVTVIGSGQSAAECVLALLNDLTPEMVAAGASIQWITRSAGFFPMEYSKL
GLEYFTPDYMRHFHRIAPVRRREIVADQGLLYKGISFSTIGEIFDLMYERSVGGRDPGLA
LFSNCAVETLESAGGSGSFRIGINHNHLDEKATVETDAIVAATGYRHAWPEWLGSLKGSV
LDTCEWGDLVVGGDFRARRSDGGKGHVFVQNAETFHHGVGAPDLGLGAFRNAVIVNQLLG
REHYRVNASASFQKFGLPSSQTAPSSISGDFYAHAS