Protein Info for SMa2406 in Sinorhizobium meliloti 1021

Annotation: RhbD rhizobactin siderophore biosynthesis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 PF13523: Acetyltransf_8" amino acids 32 to 175 (144 residues), 168.7 bits, see alignment E=3e-54

Best Hits

Swiss-Prot: 100% identical to RHBD_RHIME: Rhizobactin siderophore biosynthesis protein RhbD (rhbD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to sme:SMa2406)

MetaCyc: 100% identical to N4-hydroxy-1-aminopropane O-acetyltransferase monomer (Sinorhizobium meliloti Rm2011)
2.3.1.M54 [EC: 2.3.1.M54]

Predicted SEED Role

"Siderophore synthetase small component, acetyltransferase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.M54

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q9Z3Q9 at UniProt or InterPro

Protein Sequence (196 amino acids)

>SMa2406 RhbD rhizobactin siderophore biosynthesis protein (Sinorhizobium meliloti 1021)
MLERSEPDTALAYSRYDPDIRRTISFRLLEKQRDLKLLWRWMNQAHVVPQWKMAKPIEDI
AAYIDINLADPHQDPYIGLIDGTPMSYWEAYWAKDDVLGRYYPAEKKDRGWHMLVGEPSF
FGRGIAPAVIRAFTRFLFLDDPGTQKVVGEPSVAARRLLRYAPACAFEEQGEIDLPDKRA
KLMFCYRERFIQQFGL