Protein Info for SMa2369 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 65 to 87 (23 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 154 to 175 (22 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 250 to 267 (18 residues), see Phobius details amino acids 275 to 296 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 16 to 283 (268 residues), 112.9 bits, see alignment E=7.8e-37

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to smk:Sinme_5522)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XH1 at UniProt or InterPro

Protein Sequence (314 amino acids)

>SMa2369 ABC transporter permease (Sinorhizobium meliloti 1021)
MNAVTDIFASAGLWAAVLRIATPLILGTLGALLCERSGVLNLGIEGIMTFGAMIGWLAVY
NGADLWTGILVAGLSGGIFGLLHAGLTVTLGLSQHVSGLGVTLFASSFSYYVFRLLVPVA
GTPPTIEPFQPIDVPALSSLPFLGPALFTQTPPTYVAILLALVLGYVLFRTPLGLAIRMT
GENPHAAEAQGINPMAIRFGSVIVGSALMGIGGAFLTLSAFNSFFPTMVQGRGWICIALV
VFASWRPGRALVGALLFALFDGFQLRLQTRLSGVVPYQIFLMIPYLLSIAALALMARRAR
VPQALMQPYRRGER