Protein Info for SMa2367 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 146 to 164 (19 residues), see Phobius details amino acids 197 to 214 (18 residues), see Phobius details amino acids 238 to 262 (25 residues), see Phobius details amino acids 282 to 311 (30 residues), see Phobius details amino acids 323 to 344 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 59 to 317 (259 residues), 128.4 bits, see alignment E=1.5e-41

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to sme:SMa2367)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XH2 at UniProt or InterPro

Protein Sequence (349 amino acids)

>SMa2367 ABC transporter permease (Sinorhizobium meliloti 1021)
MRFERREHRSFALVIATPVLAILCALALAGLLIAIAGAPVMEAYWRILVGAFGSRLSATE
TLTRASPLILTGLAAAVAFRAKLWNIGAEGQFYLGAIAVAAASSHLFGGLPPPLQVPLLL
VAGAAAGIVLLLVPLWLRLRFSVDEVVTTLLLNFVAVLFVSMLIDGPLKDPMGFGWPQSQ
PVADAAVLPKLFARSRLHVGLMIALVFAVAVHLVQSRTVFGMQSRAAGLNPAGAVFAGVP
LGRTLVTVACISGGLAGLAGAIEVMGVQGYVTTDLSPGYGYSGIVVAMLANLHPLGVVLA
ALFTAVMFVGADGMSRSMGIPSYIADVTVALSLISMLTGVFFTQYRIRR