Protein Info for SMa2349 in Sinorhizobium meliloti 1021

Annotation: xanthine dehydrogenase iron-sulfur-binding subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00111: Fer2
  • amino acids 52 to 103 (52 residues), 39.8 bits, E=5.2e-14
• PF01799: Fer2_2
  • amino acids 120 to 207 (88 residues), 101.1 bits, E=4.5e-33

Best Hits

Swiss-Prot: 65% identical to PAOA_ECO57: Aldehyde oxidoreductase iron-sulfur-binding subunit PaoA (paoA) from Escherichia coli O157:H7

KEGG orthology group: K13483, xanthine dehydrogenase YagT iron-sulfur-binding subunit (inferred from 100% identity to sme:SMa2349)

MetaCyc: 65% identical to aldehyde dehydrogenase, Fe-S subunit (Escherichia coli K-12 substr. MG1655)
Carboxylate reductase. [EC: 1.2.99.6]; 1.2.98.- [EC: 1.2.99.6]; 1.2.98.- [EC: 1.2.99.6]

Predicted SEED Role

"Periplasmic aromatic aldehyde oxidoreductase, iron-sulfur subunit YagT"

KEGG Metabolic Maps

• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.99.6

Sequence Analysis Tools

See Q92XI1 at UniProt or InterPro

Protein Sequence (215 amino acids)

>SMa2349 xanthine dehydrogenase iron-sulfur-binding subunit (Sinorhizobium meliloti 1021)
MELDMQSPGALEISRRDLLAASAATVTVVSAHSLGHAQTNASTAPQSTKVTFTVNDERRE
LQLDNRTTLLDALREHLHLTGTKKGCDHGQCGACTVLIEGRRVNACLTLAIMHEGDSITT
LEGLGQPENLHPMQAAFVKHDGFQCGYCTPGQICSSVAMLDEIKANIPSHVTVDLTAPAE
ITPAEIRERMSGNICRCGAYSNIVEAITEVAGRKA