Protein Info for SMa2347 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13489: Methyltransf_23
  • amino acids 42 to 210 (169 residues), 28.5 bits, E=3e-10
• PF13847: Methyltransf_31
  • amino acids 50 to 154 (105 residues), 35.5 bits, E=2e-12
• PF13649: Methyltransf_25
  • amino acids 51 to 144 (94 residues), 49.3 bits, E=1.7e-16
• PF08242: Methyltransf_12
  • amino acids 52 to 146 (95 residues), 53.1 bits, E=1.1e-17
• PF08241: Methyltransf_11
  • amino acids 53 to 148 (96 residues), 40.7 bits, E=7.8e-14

Best Hits

KEGG orthology group: K15256, tRNA (cmo5U34)-methyltransferase [EC: 2.1.1.-] (inferred from 100% identity to sme:SMa2347)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.-

Sequence Analysis Tools

See Q92XI2 at UniProt or InterPro

Protein Sequence (226 amino acids)

>SMa2347 hypothetical protein (Sinorhizobium meliloti 1021)
MRFPSFEGPAFTAAHASSYVEGTSRKVPGLAALHRMTSMLVAERAPVQARVLVLGAGGGM
ELKALADENSDWSFCGIDPSADMLRVAEQTVGPHLLRVHLQQGYIGAAPEGPFDAAVCLL
TLHFVGRAQRLDTLEQIRRRLVPGAPFVVAHISFPQSEPERSTWIARHVAFGGTASGEAE
SARQAIATKLSVLSPEEDEAVLRKAGFSDVRLFYAAMTFRGWVGYA