Protein Info for SMa2333 in Sinorhizobium meliloti 1021

Annotation: potassium-transporting ATPase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 569 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 63 to 85 (23 residues), see Phobius details amino acids 137 to 157 (21 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 256 to 275 (20 residues), see Phobius details amino acids 285 to 305 (21 residues), see Phobius details amino acids 383 to 403 (21 residues), see Phobius details amino acids 423 to 445 (23 residues), see Phobius details amino acids 489 to 511 (23 residues), see Phobius details amino acids 531 to 554 (24 residues), see Phobius details TIGR00680: K+-transporting ATPase, A subunit" amino acids 1 to 562 (562 residues), 744.3 bits, see alignment E=4.5e-228 PF03814: KdpA" amino acids 11 to 561 (551 residues), 794.2 bits, see alignment E=2.4e-243

Best Hits

Swiss-Prot: 100% identical to KDPA_RHIME: Potassium-transporting ATPase potassium-binding subunit (kdpA) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01546, K+-transporting ATPase ATPase A chain [EC: 3.6.3.12] (inferred from 100% identity to sme:SMa2333)

MetaCyc: 53% identical to K+ transporting P-type ATPase subunit KdpA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-2 [EC: 7.2.2.6]

Predicted SEED Role

"Potassium-transporting ATPase A chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12 or 7.2.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XI9 at UniProt or InterPro

Protein Sequence (569 amino acids)

>SMa2333 potassium-transporting ATPase subunit A (Sinorhizobium meliloti 1021)
MSVIGWLQISLLFLAVLVVVKPLGLYMAGVLSGEPNVLSPILGPVERGLYGAAGIDPTRE
QGWLAYTLSMLAFSIAGFLLLFAILRLQAWMPLNPQGFGNVPPDLAFNTAVSFVTNTNWQ
NYGGETTLSHFSQMMGLTVQNFVSAATGISIALAVTRSFARSAAPTIGNFWVDLTRSTLY
VLLPLAVLVAVAFVAMGLPQTFRASVEATTLEGVKQTIALGPVASQEAIKQLGTNGGGFF
NVNAAHPFENPTALSNYLNIFAMLSVSAALLYTFGQLVGNRRQGWAFIAVTYAFLIVGVG
IVYWAEAQGNPILSQLGLDPALGNMEGKEVRFGQAMTALYATVTTGLSDGGVNGMHGSFT
GLGGLVPMFLIQLGEVLPGGIGSGLYGMIVFAILAVFVAGLMVGRTPELLGKKIEAREMK
YAMLAVLILPLSILGFTAISAVMPSAVASVGTAGPHGLSEILYAYTSAGGNNGSAFGGLS
GNTLWYNTTLGFAMLLGRFAYAVPVLAIAGSIAAKTRASTSKGTFPTDTPLFAGLLIGII
LILGGLQFLPALALGPIVEHFAMLSGQTF