Protein Info for SMa2329 in Sinorhizobium meliloti 1021

Annotation: potassium-transporting ATPase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details TIGR00681: K+-transporting ATPase, C subunit" amino acids 4 to 185 (182 residues), 208.8 bits, see alignment E=3.6e-66 PF02669: KdpC" amino acids 5 to 185 (181 residues), 239 bits, see alignment E=1.6e-75

Best Hits

Swiss-Prot: 100% identical to KDPC_RHIME: Potassium-transporting ATPase KdpC subunit (kdpC) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K01548, K+-transporting ATPase ATPase C chain [EC: 3.6.3.12] (inferred from 100% identity to sme:SMa2329)

MetaCyc: 48% identical to K+ transporting P-type ATPase subunit KdpC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-2 [EC: 7.2.2.6]

Predicted SEED Role

"Potassium-transporting ATPase C chain (EC 3.6.3.12) (TC 3.A.3.7.1)" in subsystem Potassium homeostasis (EC 3.6.3.12, TC 3.A.3.7.1)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.12

Use Curated BLAST to search for 3.6.3.12 or 7.2.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XJ1 at UniProt or InterPro

Protein Sequence (189 amino acids)

>SMa2329 potassium-transporting ATPase subunit C (Sinorhizobium meliloti 1021)
MLNQLRPALVLTFALTLITGLGYPLLITGVAQALMPAEANGSLVRKGSVLIGSQLIGQNF
ASEKYFWPRPSATGPEPYNAVASSGSNLGTTSDKLKERVAADIERLRAAGIGGEIPADAG
MASGSGLDPHISPEFARVQIARVAKARGLPEAGVDALVDRATQGRLFGLIGEPRVNVLEL
NLALDAPRT