Protein Info for SMa2311 in Sinorhizobium meliloti 1021

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 PF00005: ABC_tran" amino acids 39 to 181 (143 residues), 122.7 bits, see alignment E=2.8e-39 PF17912: OB_MalK" amino acids 255 to 309 (55 residues), 33 bits, see alignment 1.3e-11 PF08402: TOBE_2" amino acids 302 to 384 (83 residues), 36.2 bits, see alignment E=8.3e-13

Best Hits

KEGG orthology group: K02023, multiple sugar transport system ATP-binding protein (inferred from 100% identity to sme:SMa2311)

Predicted SEED Role

"Various polyols ABC transporter, ATP-binding component" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XK0 at UniProt or InterPro

Protein Sequence (408 amino acids)

>SMa2311 ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MTAASSPIFATPRNRNERNTMKSLELHRIEKSYGAYHALRGIDLSVEEGEFIVMVGPSGC
GKSTLLKTIAGLETISSGQILISGRNVTKEEPGDRGIAMVFQSYALYPHMTVAENMGFGL
RMAKRPKEEIDAAVARAAKILRITDQLDKRPKQLSGGQRQRVAIGRAITRSPDVFLFDEP
LSNLDAALRTQMRVELSGLHAELGATMIYVTHDQVEAMTMASRIVVLNRGAIEQVGSPLD
LYRNPANLFVAGFLGAPRMNFFDVTVDRVSGATAAISAPGLAPMTVSLADGVALKPGDRA
TLGIRPENIRLSPDDTTRAAISGKVRLVEHLGRETILYVDAGALQCVSSESGTGNVTVQI
GQVTPKAADTPVSLSFHPHDAYLFAGDGQRTVTVRKAIHSNQTKVGTI