Protein Info for SMa2301 in Sinorhizobium meliloti 1021

Annotation: Diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 87 to 108 (22 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 177 to 210 (34 residues), see Phobius details amino acids 222 to 239 (18 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 271 to 440 (170 residues), 168.3 bits, see alignment E=6e-54 PF00990: GGDEF" amino acids 275 to 437 (163 residues), 158.6 bits, see alignment E=6e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMa2301)

Predicted SEED Role

"FIG01074442: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XK5 at UniProt or InterPro

Protein Sequence (448 amino acids)

>SMa2301 Diguanylate cyclase (Sinorhizobium meliloti 1021)
MQLASSSAGDLASRRCSPRWARMELQESAVAASRMSASPQVRYQPRSPAVMAEVERLLAG
RTRDIRLRGELGRLFQERSWSRTAKIIRAWMIWVTLLDVLTLGLNAILLPKAVALSMLPP
ACLLPPAALATAFIWRKPRGVWLQRVSLLTGLFLILLSVALVGVSAGGEFYERHLNIMLF
VAITAIIIFAIPLAWTMTVASFALGLYLIFQLQNPGLERGSAVAGTLFFASGIIATVVAR
RTITILAQKTFLLELRDMRRVAELADANARLERLAKTDPLTGIANRRWMMETLNRLWSSG
AERRPGTAMLMCDIDDFKSLNDRLGHAEGDRCLVKVAGIIQSSVRRNRDHVARYGGEEFL
VVLPGANEEAAVATAERIRASVEAASLPNPASRVAPYVTLSIGVAAQAPGEEIVAPEKLQ
NQADAALYLAKQAGRNRVVLYQPDLPTV