Protein Info for SMa2205 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 64 to 89 (26 residues), see Phobius details amino acids 100 to 123 (24 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details amino acids 252 to 279 (28 residues), see Phobius details PF00528: BPD_transp_1" amino acids 83 to 275 (193 residues), 48.7 bits, see alignment E=3.9e-17

Best Hits

Swiss-Prot: 34% identical to POTB_ECOLI: Spermidine/putrescine transport system permease protein PotB (potB) from Escherichia coli (strain K12)

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to sme:SMa2205)

MetaCyc: 34% identical to spermidine preferential ABC transporter membrane subunit PotB (Escherichia coli K-12 substr. MG1655)
ABC-25-RXN [EC: 7.6.2.11, 7.6.2.16]; 7.6.2.11 [EC: 7.6.2.11, 7.6.2.16]

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.11 or 7.6.2.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XQ4 at UniProt or InterPro

Protein Sequence (286 amino acids)

>SMa2205 ABC transporter permease (Sinorhizobium meliloti 1021)
MTRRILPLLSPALLALLLFVAFPMVWVFRTSFNELAEGAYIVEAMTLENYTRFLTEPWYL
VNTLWFSVRIALLATAISVICAYPVALYIAKTSGLQRNVLMALTMAPLLIGLVTLVYGWI
VIFRGGGLMNSLMIALRVYDQPVRYMWDIKGVVILLVYIGTPYIVLSLLDSIERINPFLV
EAARNVGANRWTAFWKIVFPLSTPGLYAGLVIVFSLNFAAFAVPLMIGDSNTQMIGLVIY
REALLNNDLPFASALSVIMVSVNALLILGMSALAGRLILSRLEAKR