Protein Info for SMa2175 in Sinorhizobium meliloti 1021

Annotation: Integrase/recombinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 PF02899: Phage_int_SAM_1" amino acids 14 to 97 (84 residues), 40 bits, see alignment E=3.8e-14 PF00589: Phage_integrase" amino acids 124 to 296 (173 residues), 116.3 bits, see alignment E=1.3e-37

Best Hits

Swiss-Prot: 43% identical to Y4RC_SINFN: Putative integrase/recombinase y4rC (NGR_a01840) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 100% identity to sme:SMa2175)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>SMa2175 Integrase/recombinase (Sinorhizobium meliloti 1021)
MTQLAQHLTAFLREHLPRERRASVHTCDAYAYSFQLLVTFAARRLSKRPCLLQIEDIDVP
MILAFLEHIEETRGNKARSRNARLAAVKSFFRYLEHRVPAVLDQALRVHAMPMKKIDEAL
VASLSRTEVQALLNAPDRRSLSGIRDRAMLHLAFAGGLRVSELVGLTLDQFDGRSPASIH
IIGKGRRERVLPLWQETAAAIRAWIAVRPKNGDTALFLNNAGRMMTRSGFEYILEKHAAA
AVSVAPTLATKSISPHVLRHSCAMHMLQATRDIRKVALWLGHASLQSTEIYLRADPTEKL
EMLDALAPLGIKPGKFRPPDKLIAMLATR