Protein Info for SMa2141 in Sinorhizobium meliloti 1021

Annotation: formyltetrahydrofolate deformylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 TIGR00655: formyltetrahydrofolate deformylase" amino acids 9 to 285 (277 residues), 319.5 bits, see alignment E=1.1e-99 PF00551: Formyl_trans_N" amino acids 91 to 267 (177 residues), 129.1 bits, see alignment E=1.7e-41

Best Hits

Swiss-Prot: 48% identical to PURU_CORS1: Formyltetrahydrofolate deformylase (purU) from Corynebacterium sp. (strain P-1)

KEGG orthology group: K01433, formyltetrahydrofolate deformylase [EC: 3.5.1.10] (inferred from 100% identity to sme:SMa2141)

Predicted SEED Role

"Formyltetrahydrofolate deformylase (EC 3.5.1.10)" in subsystem One-carbon metabolism by tetrahydropterines (EC 3.5.1.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.10

Use Curated BLAST to search for 3.5.1.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XS5 at UniProt or InterPro

Protein Sequence (286 amino acids)

>SMa2141 formyltetrahydrofolate deformylase (Sinorhizobium meliloti 1021)
MTNVAQPFVLTLTCDDRAGIVAAVTSQLHVLGANIVESSQYWDRATNRFFMRIAFNPSGE
TSADLIERGLAPVLGQFEMQGRLIDCRKPQKIVIMISRFDHAFLHLLYQIRVGWLDAEVV
AVISNHDDSRETAAWAGIPYHFLPINRENKKKQEDRIFAIVQETEADLVVLARYMQVFSD
DIAGRLFGKVINIHHSFLPSFKGARPYHQAHEHGVKLIGATAHYVTADLDEGPIIEQETE
RVSHAMSVEDFVAAGRDIESRVLARAVKRHLEARVMLNGRKTVVFA