Protein Info for SMa2115 in Sinorhizobium meliloti 1021

Annotation: Gst13 glutathione S-transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02798: GST_N
  • amino acids 2 to 75 (74 residues), 50.8 bits, E=3.3e-17
• PF13417: GST_N_3
  • amino acids 4 to 79 (76 residues), 50.8 bits, E=3.5e-17
• PF13409: GST_N_2
  • amino acids 10 to 76 (67 residues), 50.1 bits, E=6.9e-17
• PF13410: GST_C_2
  • amino acids 125 to 193 (69 residues), 28.5 bits, E=2.6e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMa2115)

MetaCyc: 66% identical to glutathione-S-transferase NdmE (Pseudomonas putida CBB5)
RXN-11518 [EC: 1.14.13.128]

Predicted SEED Role

"Glutathione S-transferase, unnamed subgroup (EC 2.5.1.18)" in subsystem Glutathione: Non-redox reactions (EC 2.5.1.18)

MetaCyc Pathways

• 4-hydroxy-2-nonenal detoxification (1/4 steps found)
• glutathione-mediated detoxification I (3/8 steps found)
• caffeine degradation III (bacteria, via demethylation) (2/7 steps found)
• pentachlorophenol degradation (3/10 steps found)
• gliotoxin biosynthesis (2/9 steps found)
• caffeine degradation IV (bacteria, via demethylation and oxidation) (2/10 steps found)
• glutathione-mediated detoxification II (1/9 steps found)
• indole glucosinolate activation (intact plant cell) (3/12 steps found)
• camalexin biosynthesis (2/12 steps found)

KEGG Metabolic Maps

• Drug metabolism - cytochrome P450
• Glutathione metabolism
• Metabolism of xenobiotics by cytochrome P450

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.18

Use Curated BLAST to search for 1.14.13.128 or 2.5.1.18

Sequence Analysis Tools

See Q7D4I7 at UniProt or InterPro

Protein Sequence (215 amino acids)

>SMa2115 Gst13 glutathione S-transferase (Sinorhizobium meliloti 1021)
MIKLYDYELSGNCYKLRLLMSILGVDYKTVPVDFYPGREHKSEWFLKFNPLGQLPVIDDD
GLVLRDAQAILVYLAAKYDTAGSWYPRDNPELLGEISQWLAFADSITSTASAARLHDALF
YDFDIETARAGAHRLFRILDEHLWFGERQERQWICSAKHPTIADIACFPYIMLSEEGGIS
RQDYPAIRRWCDRVKRINGFIVMSGVFPAGPAKAA