Protein Info for SMa2103 in Sinorhizobium meliloti 1021

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 PF11746: DUF3303" amino acids 13 to 67 (55 residues), 22.6 bits, see alignment 1.5e-08 PF00174: Oxidored_molyb" amino acids 131 to 305 (175 residues), 187.5 bits, see alignment E=2.2e-59 PF03404: Mo-co_dimer" amino acids 326 to 437 (112 residues), 58.9 bits, see alignment E=8.7e-20

Best Hits

KEGG orthology group: K07147, (no description) (inferred from 100% identity to sme:SMa2103)

Predicted SEED Role

"Sulfur oxidation molybdopterin C protein" in subsystem Sulfur oxidation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XU3 at UniProt or InterPro

Protein Sequence (440 amino acids)

>SMa2103 oxidoreductase (Sinorhizobium meliloti 1021)
MLLNHLSRPSAARHGVLIKGEAVAQGSHSLFFIAEAADEAILQAFLAPLRQAGNVEVTAA
MTCAAMVSSGGCEERPVDVSAEVLDPADACQDAVEAGLLIHSVNPLNGETSVPDLAGGAV
MPNGRFYLRNHFDIPNLGGDNYRLSIGGLVERPLKLSMRELHNLHAESQVVTLECAGNGR
SLFDPAVPGEAWGLGAVSTAEWTGVRLMEVLERAGLRAGATELTFRGADSGVVDGHDAPV
RFERGLSLDQIRETDALLAYEMNGETLSPPHGYPLRLIVPGWYAVASVKWLTEIVVTDQP
CEAYYQAEKYWYHWVRNGHDERAQVRLMNVRALISSPEEGENLPRGDTAIRGVAWSGAGN
ISRVDVSLNGSRWREARLVGERRRSAWQWWELITRLEETGPLTVRARATDMTGRTQPEHA
EWNRLGYGNNSIHSVAARVI