Protein Info for SMa2079 in Sinorhizobium meliloti 1021

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 PF00005: ABC_tran" amino acids 24 to 174 (151 residues), 119.1 bits, see alignment E=3.5e-38 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 224 to 309 (86 residues), 91.1 bits, see alignment E=1.9e-30 PF08352: oligo_HPY" amino acids 226 to 289 (64 residues), 67.1 bits, see alignment E=2.1e-22

Best Hits

Swiss-Prot: 54% identical to Y3097_BRUAB: Putative peptide import ATP-binding protein BruAb2_0797 (BruAb2_0797) from Brucella abortus biovar 1 (strain 9-941)

KEGG orthology group: K02032, peptide/nickel transport system ATP-binding protein (inferred from 100% identity to sme:SMa2079)

MetaCyc: 51% identical to murein tripeptide ABC transporter / oligopeptide ABC transporter ATP binding subunit OppF (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]; 7.4.2.6 [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport ATP-binding protein OppF (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XV5 at UniProt or InterPro

Protein Sequence (314 amino acids)

>SMa2079 ABC transporter ATP-binding protein (Sinorhizobium meliloti 1021)
MPLISASNLKTHYKTRDGLLRSVDGVDLVVERGETVGLVGESGCGKSTLGKTLLRLVDPT
AGRIEFKGEDITALDQGRLRNVRKSIQMIFQDPFASLNPRHTIGEILEAPLIVHQAGSPP
ERRSTVASIVAKVGLPADAINRYPHEFSGGQRQRIGIARALLLNPELIVCDEPVSALDLS
IQAQILNLLVEMKKEFGLSYLFISHDLSVVRYFCDRVLVMYLGRVVESADNETLWSDPRH
PYTRALMAAVPDPSRPRQAAPLGGELPSPSNIPPGCRFHTRCPLATELCRVAEPEFRSIK
PGHRVACHVADHIN