Protein Info for SMa2067 in Sinorhizobium meliloti 1021

Annotation: sulfate/thiosulfate binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 347 TIGR00968: sulfate ABC transporter, ATP-binding protein" amino acids 4 to 243 (240 residues), 366.7 bits, see alignment E=2.5e-114 PF00005: ABC_tran" amino acids 20 to 164 (145 residues), 126 bits, see alignment E=2.7e-40 PF12857: TOBE_3" amino acids 285 to 339 (55 residues), 48.9 bits, see alignment 7.2e-17

Best Hits

Swiss-Prot: 100% identical to CYSA1_RHIME: Sulfate/thiosulfate import ATP-binding protein CysA 1 (cysA1) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02045, sulfate transport system ATP-binding protein [EC: 3.6.3.25] (inferred from 100% identity to smk:Sinme_6805)

Predicted SEED Role

"Sulfate and thiosulfate import ATP-binding protein CysA (EC 3.6.3.25)" in subsystem Cysteine Biosynthesis (EC 3.6.3.25)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.25

Use Curated BLAST to search for 3.6.3.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XW1 at UniProt or InterPro

Protein Sequence (347 amino acids)

>SMa2067 sulfate/thiosulfate binding protein (Sinorhizobium meliloti 1021)
MEVRVESLRKEFGRFPALVDVTLDILSGELIALLGPSGSGKTTLLRLIAGLESPTEGMIF
FGDEDASKRTVQERNIGFVFQHYALFRHMTVLDNVTFGLKVRPANRRPPAAEIRRRALDL
IDLVQLSGLEKRYPAQLSGGQRQRVALARAMAVEPSVLLLDEPFGALDAQVRKELRRWLR
EIHDRTGYTTLFVTHDQEEALELADRVVVMSKGAIEQVGTPDEIYDHPVSPFVYGFIGQS
NCLNVTLANGEIWFEGRPIGLRAANEPDGQATLFFRPHDVELIEGGSGCLAGRVTASRRV
AGTRHLELDLGKTQSSIEVELPPELASSADRTRIALRPTKWKLFCGE