Protein Info for SMa1996 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 transmembrane" amino acids 21 to 38 (18 residues), see Phobius details amino acids 57 to 77 (21 residues), see Phobius details amino acids 88 to 111 (24 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 163 to 183 (21 residues), see Phobius details amino acids 189 to 208 (20 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 274 to 286 (13 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details PF02653: BPD_transp_2" amino acids 49 to 313 (265 residues), 108 bits, see alignment E=2.5e-35

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to sme:SMa1996)

Predicted SEED Role

"Ribose ABC transport system, permease protein RbsC (TC 3.A.1.2.1)" in subsystem D-ribose utilization (TC 3.A.1.2.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XZ4 at UniProt or InterPro

Protein Sequence (323 amino acids)

>SMa1996 ABC transporter permease (Sinorhizobium meliloti 1021)
MTSSSSTFEKLLTSRGSRRGLWLLPLVIAIAMALWLAATTSQFGQSSNLANLVAQGMPLL
ITAVGQMFVVLVGGLDLSIGSVVSFTTAILALDLPGFVTIPAVFVLAGLIGATNGYCVTR
LSVHPIVATLSMQYIVLGITRVLRPVSGGAVPDSVRWMVEGSLFGIPLPVFWGIVTMLVA
WKLLYGSRYGLHLFAIGGGVASGSADAARNFGIPANRNILLAYVICTLFAALAGVFLAGR
IVSGDPNVGLLMELDAITAVAIGGTQLSGGVGSLHGTVIGVAALALLSNGMNLLNVTPFV
QTAIKGILLMAVVALQSRKKIGL