Protein Info for SMa1995 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 43 to 64 (22 residues), see Phobius details amino acids 71 to 89 (19 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 122 to 142 (21 residues), see Phobius details amino acids 169 to 192 (24 residues), see Phobius details amino acids 213 to 236 (24 residues), see Phobius details amino acids 243 to 261 (19 residues), see Phobius details amino acids 268 to 290 (23 residues), see Phobius details amino acids 296 to 313 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 47 to 305 (259 residues), 88.1 bits, see alignment E=2.9e-29

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to sme:SMa1995)

Predicted SEED Role

"ABC transporter, permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92XZ5 at UniProt or InterPro

Protein Sequence (316 amino acids)

>SMa1995 ABC transporter permease (Sinorhizobium meliloti 1021)
MSALVNSTGFRRISKVPPSYYLLAMLLVILFVARPQMLNANVLGVFVRQVVPLGILVLGQ
LLVMRVKSIDLSGGGVILLINYCISSGIFPGASLGFYVALALTTGLVIGLFNGVMVAKRR
VSAVIVTLALSIVLVGFVQYLSSGKPPGDVPKLFADLFNTRFAGLPSPVILWIAVTALMA
LLLSQTVFGRFVAAVGESMPAAHFSGVPVERTVILAHTLAGLMAAIAALVQTASIAVGSV
RVGLDLPVLSVAATILGGVVFGRGEGGVWGPFFGVLCFAFLFVAMTTFGVGDAGKLVAQG
MIILLAAIFYGLRAGK