Protein Info for SMa1961 in Sinorhizobium meliloti 1021

Annotation: polyhydroxybutyrate depolymerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF10503: Esterase_PHB" amino acids 45 to 243 (199 residues), 94.7 bits, see alignment E=5.2e-31 TIGR01840: esterase, PHB depolymerase family" amino acids 45 to 256 (212 residues), 209.5 bits, see alignment E=2e-66 PF00326: Peptidase_S9" amino acids 113 to 239 (127 residues), 39.2 bits, see alignment E=5.5e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMa1961)

Predicted SEED Role

"Poly(3-hydroxyalkanoate) depolymerase (EC 3.1.1.-)" (EC 3.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.-

Use Curated BLAST to search for 3.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Y13 at UniProt or InterPro

Protein Sequence (364 amino acids)

>SMa1961 polyhydroxybutyrate depolymerase (Sinorhizobium meliloti 1021)
MRSLSDTLERLARFRKDKSGHAATARSRLSRLQRFGSNPGALQAWYHVPVGLKESPALVV
VLHGCTQNAAGYDHASGWSKIAEDFGFAVLYPEQVPANNPNVCFNWFTPSDIRRGQGEVH
SIRQMVETIIVEYGIDRRRVYITGLSAGGAMANAALCAYPEIFTGGAIIAGLPFAAATTV
PEAFDRMRGHGIPDVESLRSRLSGASPHAGPWPTISVWHGTNDRTVAEANAKAIIAQWSG
VHGVPSNPSSVETVDGHKRLAWRDRSGRDAIELYLIEGMGHGTPLKVASGYGHTAPYMLD
VGISSTLHIARSWGLTPLSRRQPEKAGSVQPAPPHQAAHRSQWDRRADIQAVIERALRSA
GLMR