Protein Info for SMa1935 in Sinorhizobium meliloti 1021

Annotation: TrpR binding protein WrbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 transmembrane" amino acids 125 to 145 (21 residues), see Phobius details TIGR01755: NAD(P)H:quinone oxidoreductase, type IV" amino acids 2 to 197 (196 residues), 317 bits, see alignment E=2.9e-99 PF02525: Flavodoxin_2" amino acids 3 to 119 (117 residues), 29.3 bits, see alignment E=1.4e-10 PF00258: Flavodoxin_1" amino acids 6 to 124 (119 residues), 40.1 bits, see alignment E=8.3e-14 PF03358: FMN_red" amino acids 13 to 142 (130 residues), 63.5 bits, see alignment E=3.5e-21

Best Hits

Swiss-Prot: 100% identical to NQOR3_RHIME: NAD(P)H dehydrogenase (quinone) 3 (RA1061) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03809, Trp repressor binding protein (inferred from 100% identity to smk:Sinme_6292)

MetaCyc: 60% identical to PnpB (Pseudomonas sp. WBC-3)
2-hydroxy-1,4-benzoquinone reductase. [EC: 1.6.5.7]; p-benzoquinone reductase (NADPH). [EC: 1.6.5.7, 1.6.5.6]

Predicted SEED Role

"Trp repressor binding protein"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.5.6 or 1.6.5.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Y27 at UniProt or InterPro

Protein Sequence (212 amino acids)

>SMa1935 TrpR binding protein WrbA (Sinorhizobium meliloti 1021)
MTKMLVLYYSSYGHIEAMAKAVANGAKQAGATVALKRVPELVPEAVARSSGYRLGQEAPI
ATVAELADYDAIVIGTPTRFGNMASQMKNFLDQTGGLWAENKLVGKVGSVFTSTGSQHGG
QESTILSTHVVMLHLGMVIVGLPYSFKGQMRMDEITGGSPYGASTLAEDENHRDRSPSAN
ELDGARFQGRHVAEVAAAMQLGRSHLQPELVR