Protein Info for SMa1935 in Sinorhizobium meliloti 1021

Annotation: TrpR binding protein WrbA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01755: NAD(P)H:quinone oxidoreductase, type IV
  • amino acids 2 to 197 (196 residues), 317 bits, E=2.9e-99
• PF02525: Flavodoxin_2
  • amino acids 3 to 119 (117 residues), 29.2 bits, E=1.4e-10
• PF00258: Flavodoxin_1
  • amino acids 6 to 124 (119 residues), 40.1 bits, E=8.3e-14
• PF03358: FMN_red
  • amino acids 13 to 142 (130 residues), 63.5 bits, E=3.6e-21

Best Hits

Swiss-Prot: 100% identical to NQOR3_RHIME: NAD(P)H dehydrogenase (quinone) 3 (RA1061) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03809, Trp repressor binding protein (inferred from 100% identity to smk:Sinme_6292)

MetaCyc: 60% identical to PnpB (Pseudomonas sp. WBC-3)
2-hydroxy-1,4-benzoquinone reductase. [EC: 1.6.5.7]; p-benzoquinone reductase (NADPH). [EC: 1.6.5.7, 1.6.5.6]

Predicted SEED Role

"Trp repressor binding protein"

MetaCyc Pathways

• 2,4,5-trichlorophenoxyacetate degradation (4/9 steps found)
• 4-nitrophenol degradation I (1/5 steps found)
• 4-nitrophenol degradation II (1/5 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• gamma-Hexachlorocyclohexane degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.5.6 or 1.6.5.7

Sequence Analysis Tools

See Q92Y27 at UniProt or InterPro

Protein Sequence (212 amino acids)

>SMa1935 TrpR binding protein WrbA (Sinorhizobium meliloti 1021)
MTKMLVLYYSSYGHIEAMAKAVANGAKQAGATVALKRVPELVPEAVARSSGYRLGQEAPI
ATVAELADYDAIVIGTPTRFGNMASQMKNFLDQTGGLWAENKLVGKVGSVFTSTGSQHGG
QESTILSTHVVMLHLGMVIVGLPYSFKGQMRMDEITGGSPYGASTLAEDENHRDRSPSAN
ELDGARFQGRHVAEVAAAMQLGRSHLQPELVR