Protein Info for SMa1898 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 transmembrane" amino acids 308 to 325 (18 residues), see Phobius details PF00561: Abhydrolase_1" amino acids 34 to 145 (112 residues), 40.7 bits, see alignment E=5.8e-14 PF12697: Abhydrolase_6" amino acids 34 to 255 (222 residues), 45.1 bits, see alignment E=4.8e-15 PF12146: Hydrolase_4" amino acids 49 to 136 (88 residues), 49.9 bits, see alignment E=6.8e-17 PF02566: OsmC" amino acids 300 to 405 (106 residues), 50.5 bits, see alignment E=6e-17

Best Hits

KEGG orthology group: K06889, (no description) K07397, putative redox protein (inferred from 100% identity to sme:SMa1898)

Predicted SEED Role

"Hydrolases of the alpha/beta superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Y44 at UniProt or InterPro

Protein Sequence (408 amino acids)

>SMa1898 hypothetical protein (Sinorhizobium meliloti 1021)
MAFNTQRLQFSGHSGATLSARLDLPNGPLRAYALFAHCFTCSRDLAAARQIGAELAREGI
AVLRFDFTGLGSSEGEFASTNFSSNVADLLSAADYLRHHYQAPAVLIGHSLGGAAVLAVA
GEIPEVRAVATIGAPADVGHVLKNFGASLEEIDKNGEADVDLAGRTFLIRKQFVEDTRAH
RIKDAVGRLKKPILILHAPLDHTVGIENATEIFVAARHPKSFISLDKADHLLTDPEDAAF
AGRIISEWLTRYLAADTPQGAGPIEHVHVRETGEGKFQNAIQAGGHRLFADEPESVGGLD
AGPSPYDFLAIALGACTSMTLRLYAGHKQLKLGRIGVDVSHTKIHAKDCEECTETERGDS
RKIDRFERVISIEGEVSEELREKIVEIAGKCPVHRTLETVAKIETVVK