Protein Info for SMa1867 in Sinorhizobium meliloti 1021

Annotation: AsnC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 158 PF13404: HTH_AsnC-type" amino acids 3 to 44 (42 residues), 62.2 bits, see alignment E=4.8e-21 PF13412: HTH_24" amino acids 3 to 49 (47 residues), 72.5 bits, see alignment E=2.4e-24 PF01037: AsnC_trans_reg" amino acids 66 to 144 (79 residues), 67 bits, see alignment E=1.7e-22

Best Hits

Swiss-Prot: 46% identical to DOEX_HALED: Transcriptional regulatory protein DoeX (doeX) from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)

KEGG orthology group: None (inferred from 98% identity to smd:Smed_5590)

Predicted SEED Role

"Leucine-responsive regulatory protein, regulator for leucine (or lrp) regulon and high-affinity branched-chain amino acid transport system" in subsystem Branched-Chain Amino Acid Biosynthesis or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92Y60 at UniProt or InterPro

Protein Sequence (158 amino acids)

>SMa1867 AsnC family transcriptional regulator (Sinorhizobium meliloti 1021)
MKLDRIDIKILYELQKNGRITNVELAELVNLSPSPCLMRVKKLQSEGYIDGYSAQINVGK
LGQTLTVFTEITLKNHRQIDFARFLAAIEKVDQVIECHLVSGGYDYLLKFVTAGINEYQT
IMERLTDMDVGIDKYFSFVVLKSPIVKAHMPLTSLFRV