Protein Info for SMa1848 in Sinorhizobium meliloti 1021

Annotation: GabD5 succinate semialdehyde dehdyrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00171: Aldedh
  • amino acids 19 to 477 (459 residues), 536.5 bits, E=2.4e-165
• TIGR01780: succinate-semialdehyde dehydrogenase
  • amino acids 30 to 476 (447 residues), 666.5 bits, E=1e-204

Best Hits

Swiss-Prot: 58% identical to GABD_ECOLI: Succinate-semialdehyde dehydrogenase [NADP(+)] GabD (gabD) from Escherichia coli (strain K12)

KEGG orthology group: K00135, succinate-semialdehyde dehydrogenase (NADP+) [EC: 1.2.1.16] (inferred from 100% identity to sme:SMa1848)

MetaCyc: 58% identical to succinate-semialdehyde dehydrogenase (NADP+) GabD (Escherichia coli K-12 substr. MG1655)
SUCCSEMIALDDEHYDROG-RXN [EC: 1.2.1.79]; Glutarate-semialdehyde dehydrogenase. [EC: 1.2.1.79, 1.2.1.20]

Predicted SEED Role

"Aldehyde dehydrogenase (EC 1.2.1.3)" in subsystem Entner-Doudoroff Pathway or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Methylglyoxal Metabolism or Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 1.2.1.3)

MetaCyc Pathways

• TCA cycle IV (2-oxoglutarate decarboxylase) (8/9 steps found)
• ethanol degradation II (3/3 steps found)
• ethanol degradation IV (3/3 steps found)
• 4-aminobutanoate degradation II (2/2 steps found)
• 4-aminobutanoate degradation III (2/2 steps found)
• superpathway of NAD/NADP - NADH/NADPH interconversion (yeast) (6/8 steps found)
• phytol degradation (3/4 steps found)
• superpathway of glycol metabolism and degradation (5/7 steps found)
• ethanol degradation III (2/3 steps found)
• hypotaurine degradation (2/3 steps found)
• putrescine degradation IV (2/3 steps found)
• superpathway of 4-aminobutanoate degradation (2/3 steps found)
• L-lysine degradation X (4/6 steps found)
• superpathway of L-arginine and L-ornithine degradation (9/13 steps found)
• ethylene glycol degradation (1/2 steps found)
• putrescine degradation I (1/2 steps found)
• putrescine degradation V (1/2 steps found)
• mitochondrial NADPH production (yeast) (3/5 steps found)
• superpathway of ornithine degradation (5/8 steps found)
• D-arabinose degradation II (2/4 steps found)
• L-tryptophan degradation X (mammalian, via tryptamine) (2/4 steps found)
• fatty acid α-oxidation I (plants) (2/4 steps found)
• superpathway of L-arginine, putrescine, and 4-aminobutanoate degradation (7/11 steps found)
• histamine degradation (1/3 steps found)
• 3-methyl-branched fatty acid α-oxidation (3/6 steps found)
• Entner-Doudoroff pathway II (non-phosphorylative) (5/9 steps found)
• L-lysine degradation IV (2/5 steps found)
• octane oxidation (2/5 steps found)
• putrescine degradation III (1/4 steps found)
• L-lysine degradation I (3/7 steps found)
• serotonin degradation (3/7 steps found)
• dopamine degradation (1/5 steps found)
• 4-hydroxyphenylacetate degradation (3/8 steps found)
• ceramide degradation by α-oxidation (2/7 steps found)
• sphingosine and sphingosine-1-phosphate metabolism (4/10 steps found)
• L-lysine degradation III (1/6 steps found)
• alkane oxidation (1/6 steps found)
• limonene degradation IV (anaerobic) (1/7 steps found)
• aromatic biogenic amine degradation (bacteria) (1/8 steps found)
• nicotine degradation II (pyrrolidine pathway) (3/11 steps found)
• noradrenaline and adrenaline degradation (4/13 steps found)
• nicotine degradation I (pyridine pathway) (5/17 steps found)
• ceramide and sphingolipid recycling and degradation (yeast) (4/16 steps found)
• superpathway of pentose and pentitol degradation (21/42 steps found)
• superpathway of L-lysine degradation (15/43 steps found)

KEGG Metabolic Maps

• 1,2-Dichloroethane degradation
• 3-Chloroacrylic acid degradation
• Arginine and proline metabolism
• Ascorbate and aldarate metabolism
• Butanoate metabolism
• Fatty acid metabolism
• Glutamate metabolism
• Glycerolipid metabolism
• Glycolysis / Gluconeogenesis
• Histidine metabolism
• Limonene and pinene degradation
• Lysine degradation
• Propanoate metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Urea cycle and metabolism of amino groups
• Valine, leucine and isoleucine degradation
• beta-Alanine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.16, 1.2.1.3

Use Curated BLAST to search for 1.2.1.16 or 1.2.1.20 or 1.2.1.3 or 1.2.1.79

Sequence Analysis Tools

See Q92Y70 at UniProt or InterPro

Protein Sequence (484 amino acids)

>SMa1848 GabD5 succinate semialdehyde dehdyrogenase (Sinorhizobium meliloti 1021)
MRLKDRELFRQLGLIGGEWIAGASGVVVDVIDPANQAVLGTVPDMGTAETRAAIEAANAA
FGPWKKKTHAERAAVLERWHALMIENLEDLAVLVTMEQGKPLEEARGEIRYGAAFVKWFA
EESRRIGGHTIPSPTSDRRIVVLKEAVGVCAIVTPWNFPNAMITRKVAPALAAGCTVVIK
PSEFTPFSALALGVLAERAGIPAGVVNIVTGMPTAIGNEFMTNETVRKISFTGSTRVGSL
LMRGAADSVKRLSLELGGNAPFIVFDDANLDLAVEGAIASKFRNGGQTCVCANRILVQAG
VYDAFAEKLGARVNAMKVGPGTEPGIAIGPMINEAAIDKIDRHVEDAIAKGAKLAARGRS
VPEGRQYTAPIVLTGATTDMLLASEETFGPVAPLFRFETEDEAIAIANGTPFGLAAYFYT
EGLKRSWRVAEALEFGMIGLNTGAISTEVAPFGGVKQSGLGREGAQVGIEEYLEMKSFHI
GGLD