Protein Info for SMa1753 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 signal peptide" amino acids 1 to 40 (40 residues), see Phobius details transmembrane" amino acids 179 to 199 (21 residues), see Phobius details amino acids 210 to 233 (24 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details amino acids 308 to 333 (26 residues), see Phobius details amino acids 360 to 382 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 193 to 384 (192 residues), 44.6 bits, see alignment E=7.1e-16

Best Hits

KEGG orthology group: K02054, putative spermidine/putrescine transport system permease protein (inferred from 100% identity to sme:SMa1753)

Predicted SEED Role

"Spermidine Putrescine ABC transporter permease component PotB (TC 3.A.1.11.1)" in subsystem Polyamine Metabolism (TC 3.A.1.11.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YB7 at UniProt or InterPro

Protein Sequence (392 amino acids)

>SMa1753 ABC transporter permease (Sinorhizobium meliloti 1021)
MSAVSSRAGRSVALLAPLLLFLIGFFVWPLLSMMSQAVSDQAVLSLLPRSAVVLTDWDRK
SPPTVPMQMALMEDLKAVDDDQALGDMVRRLNSARSGFRTLMSKTTRALDDTANPPANLV
SIDKRWEKPEFWLAIADALSPLTDRNLLAAVDLGRNSTGDIEHLPADQSVNRVILVRTFW
IAALVTFACAGIGFPYAMIAASLTGWKRDLMLAAVLLPLWTSLLVRTAAWFILLQEKGLI
NDLLQTLGLINAPLPLIFNRTGVVIAMTHVLLPFMVLPIYSVLITIPKNLMPAAASLGAP
PWRAFLRVLLPLSLRGLASGSLLVFISAIGYYITPALIGGPGDQMISSIIAFYAMGSANW
GMAGALGVVLLVATLLLYGVYARLSTGEPGRR