Protein Info for SMa1745 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease, Fe3+-siderophore transport system

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 transmembrane" amino acids 43 to 62 (20 residues), see Phobius details amino acids 94 to 112 (19 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 150 to 170 (21 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 227 to 245 (19 residues), see Phobius details amino acids 271 to 297 (27 residues), see Phobius details amino acids 311 to 331 (21 residues), see Phobius details amino acids 340 to 358 (19 residues), see Phobius details PF01032: FecCD" amino acids 51 to 360 (310 residues), 297.1 bits, see alignment E=6.8e-93

Best Hits

KEGG orthology group: K02015, iron complex transport system permease protein (inferred from 100% identity to sme:SMa1745)

Predicted SEED Role

"ABC-type Fe3+-siderophore transport system, permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YC3 at UniProt or InterPro

Protein Sequence (366 amino acids)

>SMa1745 ABC transporter permease, Fe3+-siderophore transport system (Sinorhizobium meliloti 1021)
MGPEGLREAAQRGSQEVAMTAGIIKTSDGRWSPVSRSNRMRSLWLAALFALVIVLLAASV
TVGTRNVGWDDVAAAMGGAQNNIDRASVALRIPRTVLALLAGGALGLAGAIMQGVTRNPL
ADPGILGVNMGASLAVVVGVAWFGMSSLYAYIWVAILGAGCAAIFVYAIGSLGRGGATPL
KMALAGAATSVAFASMVIAVVLPRGDIAGGIHSWQIGGVGGATYERILPVLPFLLVGFVI
SLLSARKLNSLALGDELATGLGESVATARAVASLGAILLCGATTAICGPIGFLGLVVPHL
CRLLVGVDHRWLLPFSTLAGACLLLAADVLGRIVARPAEIDVGIVTAMIGAPFFIWIVRR
QRVRDL