Protein Info for SMa1724 in Sinorhizobium meliloti 1021

Annotation: Isochorismatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 181 PF00857: Isochorismatase" amino acids 5 to 147 (143 residues), 128.9 bits, see alignment E=1.2e-41

Best Hits

Swiss-Prot: 45% identical to YDDQ_BACSU: Uncharacterized isochorismatase family protein YddQ (yddQ) from Bacillus subtilis (strain 168)

KEGG orthology group: K05993, isochorismatase [EC: 3.3.2.1] (inferred from 100% identity to sme:SMa1724)

Predicted SEED Role

"Isochorismatase (EC 3.3.2.1)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. (EC 3.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YD7 at UniProt or InterPro

Protein Sequence (181 amino acids)

>SMa1724 Isochorismatase (Sinorhizobium meliloti 1021)
MSKRAIIVVDLQNDYLTTGKFPLVGIDKALENAARLVDAARRSGDLVVNIRHESPAGAPF
FVSGTEGAEIIPNIAPQHGEAVVTKRYPNSFRETELASLLSSAGVDEVTVIGAMSHMCID
ATARAASDLGYKTTVVEDACATRDLEFRGEVVPAAKVHAAYMSALAFGYGQVVSTRDYLA
K