Protein Info for SMa1686 in Sinorhizobium meliloti 1021

Annotation: Two-component response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 PF00072: Response_reg" amino acids 8 to 117 (110 residues), 94.8 bits, see alignment E=5.8e-31 PF08281: Sigma70_r4_2" amino acids 135 to 186 (52 residues), 30.7 bits, see alignment E=2.9e-11 PF00196: GerE" amino acids 143 to 198 (56 residues), 68.9 bits, see alignment E=3.6e-23

Best Hits

Swiss-Prot: 39% identical to TODT_PSEPU: Response regulator protein TodT (todT) from Pseudomonas putida

KEGG orthology group: None (inferred from 100% identity to sme:SMa1686)

Predicted SEED Role

"Nitrogen regulation protein NR(I)" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YF4 at UniProt or InterPro

Protein Sequence (213 amino acids)

>SMa1686 Two-component response regulator (Sinorhizobium meliloti 1021)
MNDLEPIVHIVDDDQSFRTAVGRLLAASGFRVALYESGDQFLAQFADGEPGCVLLDLGLP
GLSGLELQDRLAEKAPLLPIVFLTGRGDIRATVQAMKAGAEDFLEKPTPKEVLLETIGRA
LRRYALRRLEQDRKHALRRRLANLTPREFEVFGLIVRGKLNKQIAQALGTSERTVKAHRH
NLMEKLGTRSLAETVSIAERLGLVDSAADQLQR