Protein Info for SMa1676 in Sinorhizobium meliloti 1021

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 352 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 31 to 47 (17 residues), see Phobius details amino acids 59 to 84 (26 residues), see Phobius details amino acids 142 to 159 (18 residues), see Phobius details amino acids 195 to 214 (20 residues), see Phobius details amino acids 226 to 252 (27 residues), see Phobius details amino acids 259 to 278 (20 residues), see Phobius details amino acids 298 to 323 (26 residues), see Phobius details PF01594: AI-2E_transport" amino acids 15 to 325 (311 residues), 115.1 bits, see alignment E=2.3e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMa1676)

Predicted SEED Role

"transporter, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YG1 at UniProt or InterPro

Protein Sequence (352 amino acids)

>SMa1676 hypothetical protein (Sinorhizobium meliloti 1021)
MPAARIKIIYITQILIATLLLLAMLSMASSIFAPVAFALFIIALVWPTQCRLQAMLPRYL
ALIISFLLVVLAIVAFGGLIAWAFGHVGRWIIADAARFQQLYDQVRLWLEEHGVAVGVLW
SENFGVGWVLHTVQAVSGRLNSTFSFWLIALVYVLLGLMEMDDFGRRIEALRNRTASALL
LRGSQQTAMKIRRYMMIRTVMSVVTGLLVWIFTRAVGLSLAEEWGFIAFALNYIPFLGPL
LATLFPTLFALIQFGTVETVLIVFTGLNLIQFVVSSYIEPRASGSALSMSPVMVLFSVFL
WGYLWGIFGAFIGVPITIALLTFCNQHPSSKWLSELFGLEMAADQVASTPSG