Protein Info for SMa1652 in Sinorhizobium meliloti 1021

Annotation: hydantoin racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 PF01177: Asp_Glu_race" amino acids 3 to 208 (206 residues), 179.6 bits, see alignment E=3.8e-57

Best Hits

Swiss-Prot: 48% identical to HYDRA_PSESN: Hydantoin racemase (hyuE) from Pseudomonas sp. (strain NS671)

KEGG orthology group: K01797, [EC: 5.1.99.-] (inferred from 100% identity to sme:SMa1652)

MetaCyc: 52% identical to allantoin racemase monomer (Klebsiella pneumoniae)

Predicted SEED Role

"Hydantoin racemase (EC 5.1.99.-)" in subsystem Hydantoin metabolism (EC 5.1.99.-)

Isozymes

Compare fitness of predicted isozymes for: 5.1.99.-

Use Curated BLAST to search for 5.1.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YH6 at UniProt or InterPro

Protein Sequence (261 amino acids)

>SMa1652 hydantoin racemase (Sinorhizobium meliloti 1021)
MLIKLINPNTTSAMTELMGDTARTVAAAGSDIVLATSRSGAASIEGHYDEALSILGVIDE
IARGKPADAYIIGCFGDPGLLAAREITASPVLGVAESAMHAATFVATSFSIITTLERTRI
ISERLVRSYGMQNHCRSVRATDVPVLELERSSSTADAAILAECEKALIEDRAQAIVLGCA
GMSNLVERLQHRLGVPVIDGVAAAVKFAEGIVGMGLRTSKVGDLAYPLPKAYAGKLAEYA
PASLKLRNNDEPSALATAIGS