Protein Info for SMa1561 in Sinorhizobium meliloti 1021

Annotation: chemotaxis protein CheB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 PF01339: CheB_methylest" amino acids 162 to 338 (177 residues), 197.1 bits, see alignment E=9.9e-63

Best Hits

Swiss-Prot: 100% identical to CHEB3_RHIME: Protein-glutamate methylesterase/protein-glutamine glutaminase of group 3 operon (cheB3) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K03412, two-component system, chemotaxis family, response regulator CheB [EC: 3.1.1.61] (inferred from 100% identity to sme:SMa1561)

Predicted SEED Role

"Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)" in subsystem Bacterial Chemotaxis (EC 3.1.1.61)

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.61

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YM4 at UniProt or InterPro

Protein Sequence (354 amino acids)

>SMa1561 chemotaxis protein CheB (Sinorhizobium meliloti 1021)
MVRILLATSTVELEDLVKRAIEGDASAELVLIARSGREAVRMTGELLPDIVAVELCPSGD
DSAETVREIMIAAPTPVVMLSHRDGSQLGTISARALEAGALAVIPAPAAHGMQLEQPAIE
KFLSTIKAMSQVKVVRQWRQKVRGDRAAKDQPPTARTPIGIVGIAASTGGPAAIRAILKD
ISADLPVPILIVQHMSNGFIDGVAASLNATVPLTVKVARNGELLKPGTVYLAPDNCQLGV
SGRSRLRVSDDAPVNGFKPSGSYLFGSIARAFKGESLAVVLTGMGDDGTEGLRALRMAGG
KAIAQDEKSSVVFGMPKSAIGAGLVDLVLPLESIAENITAIARGRSEPEGETRT