Protein Info for SMa1545 in Sinorhizobium meliloti 1021

Annotation: NuoJ2 NADH:quinone oxidoreductase subunit 6 (chain J)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00499: Oxidored_q3
  • amino acids 17 to 160 (144 residues), 135 bits, E=8.5e-44

Best Hits

KEGG orthology group: K00339, NADH dehydrogenase I subunit J [EC: 1.6.5.3] (inferred from 99% identity to smk:Sinme_6036)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain J (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

See G3XCP6 at UniProt or InterPro

Protein Sequence (166 amino acids)

>SMa1545 NuoJ2 NADH:quinone oxidoreductase subunit 6 (chain J) (Sinorhizobium meliloti 1021)
MHQGFFLLFATVSVVTALTLVLARNPVHSALALMACFLQISAIFVMLGAPLLAVIQIFVY
VGAIMVLFLFVIMMVDVREAVLQRFMPGGNLPALALLVLLGAEMVVLVLWSDRFIESPPV
AERGGDAIRDLSKTLFSDYLLPFEVASVILLAALVGAIVLARKEPG