Protein Info for SMa1533 in Sinorhizobium meliloti 1021

Annotation: NuoA2 NADH I chain A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 62 to 85 (24 residues), see Phobius details amino acids 91 to 113 (23 residues), see Phobius details PF00507: Oxidored_q4" amino acids 22 to 119 (98 residues), 120.7 bits, see alignment E=1.3e-39

Best Hits

Swiss-Prot: 100% identical to NUOA2_RHIME: NADH-quinone oxidoreductase subunit A 2 (nuoA2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00330, NADH dehydrogenase I subunit A [EC: 1.6.5.3] (inferred from 100% identity to sme:SMa1533)

MetaCyc: 40% identical to ferredoxin-plastoquinone oxidoreductase subunit C (Synechococcus elongatus PCC 7942 = FACHB-805)

Predicted SEED Role

"NADH ubiquinone oxidoreductase chain A (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P56895 at UniProt or InterPro

Protein Sequence (121 amino acids)

>SMa1533 NuoA2 NADH I chain A (Sinorhizobium meliloti 1021)
MTAMEFLPVLFMVTGIVLVAAATLFVSSLLRPSNPYPEKNAPYECGMEAAGEAAGGRFRV
PFFILAILLVVFDVEAMFLFPWAVVLKEIGFVGYIEMFVFMLLLLVGFAYAWLKGALEWQ
E