Protein Info for SMa1532 in Sinorhizobium meliloti 1021

Annotation: NADH dehydrogenase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01957: NADH-quinone oxidoreductase, B subunit
  • amino acids 12 to 152 (141 residues), 241.7 bits, E=1.1e-76
• PF01058: Oxidored_q6
  • amino acids 38 to 144 (107 residues), 101.1 bits, E=1.9e-33

Best Hits

Swiss-Prot: 100% identical to NUOB2_RHIME: NADH-quinone oxidoreductase subunit B 2 (nuoB2) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K00331, NADH dehydrogenase I subunit B [EC: 1.6.5.3] (inferred from 100% identity to sme:SMa1532)

MetaCyc: 59% identical to ferredoxin-menaquinone dehydrogenase subunit B (Helicobacter pylori 26695)
7.1.1.-

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain B (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration III (alternative oxidase pathway) (3/3 steps found)
• NADH to cytochrome bo oxidase electron transfer I (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NAD(P)/NADPH interconversion (3/6 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

See P56897 at UniProt or InterPro

Protein Sequence (167 amino acids)

>SMa1532 NADH dehydrogenase subunit B (Sinorhizobium meliloti 1021)
MAGVNDAIRDSVLFTTADSIISWSRRSALWPETFGIACCAIEMISAGCARYDLDRFGVVF
RPSPRQSDVMIIAGTVTRKFAPVVRRLYDQMPEPRWVIAMGTCAISGGVYNTYAVVQGSE
TFVPVDVHVPGCPPRPEALMHGFLLLQEKIKKSRALTGTPLGRVIAS