Protein Info for SMa1513 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details transmembrane" amino acids 49 to 67 (19 residues), see Phobius details amino acids 77 to 95 (19 residues), see Phobius details amino acids 101 to 124 (24 residues), see Phobius details amino acids 133 to 153 (21 residues), see Phobius details amino acids 184 to 201 (18 residues), see Phobius details amino acids 231 to 253 (23 residues), see Phobius details amino acids 266 to 296 (31 residues), see Phobius details amino acids 310 to 334 (25 residues), see Phobius details PF02653: BPD_transp_2" amino acids 46 to 324 (279 residues), 136.7 bits, see alignment E=4.3e-44

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to smk:Sinme_6017)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YP1 at UniProt or InterPro

Protein Sequence (340 amino acids)

>SMa1513 ABC transporter permease (Sinorhizobium meliloti 1021)
MRIAAPVIATALTFLAGSVLFAALGYDPLATLHAFFVAPINSTNGLSEWLLKASPLILIA
CGLAVGFRANIWNIGAEGQLIIGAIAACGVGLFYPDPESPLLIPLMFLAGAGAGMAWAAI
PAFLRARMNTNEILVTLMLTYIATLLLSFLVHGPWRDPAGFNYPQTALLPAAAMFEPFDY
SYRLNPSIFITAVAVVMMWLFTDRSFLGYKMSVSGAAPLAARYAGFRESSAVWTGLLAGG
AAAGIAGMAEVAGPLGQLSPQISPGYGFAAIIVAFIGRLNAFGIVLGGLLMSLLFLGGET
VQMTLGLPAALTRIFQGILLFFLLAADFFIYYRLRLPEHA