Protein Info for SMa1476 in Sinorhizobium meliloti 1021

Annotation: AraC family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details PF01965: DJ-1_PfpI" amino acids 36 to 160 (125 residues), 34.3 bits, see alignment E=3.1e-12 PF12833: HTH_18" amino acids 224 to 303 (80 residues), 84.2 bits, see alignment E=9.5e-28 PF00165: HTH_AraC" amino acids 265 to 301 (37 residues), 30.3 bits, see alignment 5.4e-11

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_5998)

Predicted SEED Role

"transcriptional regulator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YQ9 at UniProt or InterPro

Protein Sequence (318 amino acids)

>SMa1476 AraC family transcriptional regulator (Sinorhizobium meliloti 1021)
MFPNFPLMAFSSVIEPLRAANTLSGRRCYSWLTVAAGEKISASNGIGIEPDFHVRNAPEV
DRIVVCSGGDAEHLVADEEMAWIRKNLRAGAQLGAVADAAFFLARKGLLDGHSCTLHWTS
QPAFKEAFPHLDMRSDLYVIDRRRFTSVGGIGSLDMMLDMIGRDYGAELADGVAGWFMHS
PLRPDADRRKLTLRIRSGIADDLVLSAVAMMEDAIEDVLRIEDLASRLNVSSDKLERAFK
AELGVSPNSYYRNLRLGHAADMLTHSNLKVNEVAVACGFVNAANFSRAFKEQFGYVPHSV
RRRVSRAGEAPRAVAGLK