Protein Info for SMa1473 in Sinorhizobium meliloti 1021

Annotation: aminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 434 PF01321: Creatinase_N" amino acids 51 to 197 (147 residues), 49.9 bits, see alignment E=4.7e-17 PF00557: Peptidase_M24" amino acids 205 to 414 (210 residues), 116.6 bits, see alignment E=1.4e-37

Best Hits

KEGG orthology group: None (inferred from 100% identity to sme:SMa1473)

Predicted SEED Role

"Aminopeptidase YpdF (MP-, MA-, MS-, AP-, NP- specific)" in subsystem Protein degradation

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YR0 at UniProt or InterPro

Protein Sequence (434 amino acids)

>SMa1473 aminopeptidase (Sinorhizobium meliloti 1021)
MSIVVFDPDSVDDVDFKDRMRHPETADPAGGMWLSDTEPSFIDADALRNGRLKKLRDWMR
AAGYGAVVLFDPYNQRYATGSRNMFGYFLRNSTRYFFIPTEGPVVLFEYPQSYHVSMVLD
TIDEARPSKLVWSSVSGKDDETAGPFADEITDLLKQHGGGSMKLGMDRCSHLQALALEKR
GCEVKDCQGEILAVRAVKTPEEIKCLQVSMAGAEAAVAAVREAIKPGVFETKLFAIMYHE
VIRQGGEFIETRLLSSGQRTNPWFNEASGRKIRPGELVALDTDTIGCYGYYSDFSRTFRC
GPGKPTPYQKSLYRMAYDQVQHNIDIVKPGMAFREIAEKAWKIPDRFVDQRYTSVMHGVG
MHGETPFIAHAMDYETYGRDGYLVPGMVVSVESYIGEKGGREGVKLEDEILITENGTELL
SRFPYEDEFLSGET