Protein Info for SMa1418 in Sinorhizobium meliloti 1021

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 73 to 98 (26 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details amino acids 232 to 252 (21 residues), see Phobius details amino acids 261 to 281 (21 residues), see Phobius details amino acids 287 to 305 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 35 to 299 (265 residues), 108.8 bits, see alignment E=1.4e-35

Best Hits

KEGG orthology group: K02057, simple sugar transport system permease protein (inferred from 100% identity to sme:SMa1418)

Predicted SEED Role

"Nucleoside ABC transporter, permease protein 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YT7 at UniProt or InterPro

Protein Sequence (313 amino acids)

>SMa1418 ABC transporter permease (Sinorhizobium meliloti 1021)
MDIQRLKPHLPWITLTVLVAIVGMADPGFLKPQNLMSLAGDIVPLFIMALGLTFAIYIGG
IDLSAQSMANMVTVIASVYLASMGAWVALLCVAAGFLLGTLSGYITTRLYVPSFISTLAV
GGVAFSVAQWLSGQRALNMDAAQRNETFGWMIGRTWGVPNELLIAAVLLLVCLFIERRTI
LGRALKAVGAGELAAAASGLNVARYKILAFAISGALAAIAGLLFAVKLSGGAPTIANGFL
LPAIVAVLVGGTPLTGGVGGVLNTVIGTLIVAVIRASMLYFEIDATQQQMVFGIVLIGAI
ALTIDRAKLRTVK