Protein Info for SMa1417 in Sinorhizobium meliloti 1021

Annotation: Dehydrogenase, Zn-dependent

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 PF08240: ADH_N" amino acids 25 to 130 (106 residues), 114.2 bits, see alignment E=5.4e-37 PF16912: Glu_dehyd_C" amino acids 141 to 325 (185 residues), 40 bits, see alignment E=6.3e-14 PF00107: ADH_zinc_N" amino acids 171 to 300 (130 residues), 85.7 bits, see alignment E=5.3e-28 PF13602: ADH_zinc_N_2" amino acids 205 to 326 (122 residues), 35 bits, see alignment E=5.3e-12

Best Hits

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_5968)

MetaCyc: 31% identical to NAD+-dependent secondary alcohol dehydrogenase I monomer (Gordonia sp. TY-5)
1.1.1.M22 [EC: 1.1.1.M22]

Predicted SEED Role

"Sorbitol dehydrogenase (EC 1.1.1.14)" in subsystem Ribitol, Xylitol, Arabitol, Mannitol and Sorbitol utilization (EC 1.1.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.14

Use Curated BLAST to search for 1.1.1.14 or 1.1.1.M22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YT8 at UniProt or InterPro

Protein Sequence (341 amino acids)

>SMa1417 Dehydrogenase, Zn-dependent (Sinorhizobium meliloti 1021)
MKAAVLVEPRRFEVREVGIPEIGPADVLIRVTRAGICGTDLHIFNGHYAADRLPIVPGHE
FCGTIAEIGASVTHLKTGMRVVADINIGCGNCYWCRRNEVLNCGEVEQIGIGRDGAFAQY
VALPGRLVLPVPDGVPEAVLALVEPVACVVRAARKAGAAFGRSGVVLGAGPIGNLHVQMM
RLVGMAPIIVADLSSERCRMAVEAGADAAVSEPATLRSKVLEMTGGRGADFVVESVGSSK
LYRQAFDLVRKGGHVAFFGITPPGETIPIEILRTVLEENSLKGSVAGMGEDMHDALTLLS
HGRFRTAAFTAAHYPLERIQEAFETIPARTGHLKTQILLDA