Protein Info for SMa1415 in Sinorhizobium meliloti 1021

Annotation: aldehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 41% identical to AL1A2_HUMAN: Retinal dehydrogenase 2 (ALDH1A2) from Homo sapiens

KEGG orthology group: None (inferred from 100% identity to smk:Sinme_5967)

MetaCyc: 75% identical to L-sorbosone dehydrogenase subunit (Gluconobacter oxydans UV10)
1.1.1.M58 [EC: 1.1.1.M58]

Predicted SEED Role

"Phenylacetaldehyde dehydrogenase (EC 1.2.1.39)" in subsystem Aromatic Amin Catabolism (EC 1.2.1.39)

MetaCyc Pathways

2-keto-L-gulonate biosynthesis (3/4 steps found)
L-phenylalanine degradation II (anaerobic) (2/3 steps found)
phenylethanol degradation (1/2 steps found)
phenylethylamine degradation I (1/2 steps found)
phenylethylamine degradation II (1/2 steps found)
styrene degradation (1/3 steps found)
superpathway of phenylethylamine degradation (6/11 steps found)
L-phenylalanine degradation IV (mammalian, via side chain) (4/9 steps found)
anaerobic aromatic compound degradation (Thauera aromatica) (3/27 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.M58 or 1.2.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q92YT9 at UniProt or InterPro

Protein Sequence (498 amino acids)

>SMa1415 aldehyde dehydrogenase (Sinorhizobium meliloti 1021)
MDQLNNFLSPPAAPRDFGFFVDGKWQSGHDFFVRHSPGHGVAVTRTAKCSVDDLNAAVAA
ARRAFEDRRWSGLPGGSRASVLLRVAEILRTRRDELAYWETLENGKPIAQARGEIDHCIA
CFEVGAGAARLLHGDSFNSLGDGLFGMVLREPIGVVGLITPWNFPFLILCERVPFILASG
CTMVVKPSEVTSATTLILAEVLAEAGLPDGVYNVITGSGRTIGQAMSEHPDIDMLSFTGS
TAVGRSCVHAAADSNFKKLGLELGGKNPIIVFADSDLEDAADGAAFGISFNTGQCCVSSS
RLIVERSVAREFEALLAEKMKRIRVGDPLDETTQVGAITTEAQNTTILDYIAKGKTEGAE
LVTGGTAIDLGRGQYIAPTLFSGVSREMAIARDEIFGPVLCSMTFDTVEQAVELANDTVY
GLAASVWTKNIDKALTVTRRVRAGRFWVNTMMAGGPEMPLGGFKQSGWGREAGMYGVEEY
TQVKSVHVEIGKRTHWIS